Tesamorelin 10mg
$79.99
Synthetic GHRH receptor agonist peptide (research compound).
Purity: 99% | CoA: see the Certificate of Analysis table in the Description tab.
For research use only. Not for human or veterinary use. Not a drug, food, dietary supplement or cosmetic, and not intended to diagnose, treat, cure or prevent any disease.
Disclaimer: For Research Use Only
This compound is provided exclusively for in vitro research purposes. It is not FDA-approved and is not intended for human, therapeutic, diagnostic, or veterinary use. By purchasing, you confirm that you are a qualified researcher aged 21 or older.
- HPLC Verified
- COA Included
- For 21+ Only
- US Sourced
Description
Compound Profile
Tesamorelin is a synthetic peptide characterised as a growth hormone-releasing hormone (GHRH) receptor agonist, supplied as a research material for in vitro laboratory investigation.
| Compound Type | Synthetic peptide / Growth hormone-releasing hormone (GHRH) receptor agonist |
| CAS Number | 218949-48-5 (901758-09-6 as acetate salt) |
| Molecular Weight | ~5,135.86 g/mol (Da) |
| Amino Acids | 44 residues |
| Sequence | (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NHâ‚‚ |
| Formula | C221H366N72O67S |
Certificate of Analysis (CoA)
Quality specifications for this product are summarised below.
| Test | Method | Specification |
|---|---|---|
| Purity | HPLC | 99% |
| Identity | Mass spectrometry | Consistent with theoretical molecular weight (~5,135.86 g/mol (Da)) |
| Quantity per vial | Gravimetric | 10mg |
Research Use Only (RUO) Disclaimer
This product is sold strictly for in vitro laboratory research and analytical use by qualified professionals. For research use only. Not for human or veterinary use. Not a drug, food, dietary supplement or cosmetic, and not intended to diagnose, treat, cure or prevent any disease. Not for ingestion, injection or any form of administration to humans or animals. Handle only in accordance with applicable laboratory safety practices and regulations.
This product is sold strictly for in vitro laboratory research and analytical use by qualified professionals. For research use only. Not for human or veterinary use. Not a drug, food, dietary supplement or cosmetic, and not intended to diagnose, treat, cure or prevent any disease. Not for ingestion, injection or any form of administration to humans or animals. Handle only in accordance with applicable laboratory safety practices and regulations.
Additional information
| Size | 10mg |
|---|---|
| Compound Type | Synthetic peptide / Growth hormone-releasing hormone (GHRH) receptor agonist |
| CAS Number | 218949-48-5 (901758-09-6 as acetate salt) |
| Molecular Weight | ~5, 135.86 g/mol (Da) |
| Amino Acids | 44 residues |
| Sequence | (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NHâ‚‚ |
| Formula | C221H366N72O67S |
| Purity | 99% |
Reviews (0)
Related Peptides
Explore high-quality research compounds selected for controlled laboratory workflows, consistent handling and dependable analytical study.
Reviews
There are no reviews yet.